Sale!

weprideourselvesontakingcareofeverycustomerweserveasiftheywerefamilymembershelpingcustomersfindthechristmasjumbonelargedogtreatwithturkeyflavour12chewspedigree0.png

Christmas Jumbone Large Dog Treat with Turkey Flavour 12 Chews Pedigree

$ 13,10

SKU: mode_6923704434828 Category: Pet Food Tags: Dog Food, Non-Discountable

Description
shopping

Deliciously satisfying and long-lasting dog chews with a tough and tasty outer and a mouth-watering centre.
Low-fat dog treats for guilt-free rewards. Pedigree Jumbone dog chews have less than 5% fat / 100g
Turkey dog treats with omega 3 to help keep them fit for life, vitamins to help maintain your dog’s natural defences and minerals including calcium to help give them strong bones.
Delicious dog chew sticks that contain no artificial colours or flavours – just low-fat goodness that your canine will love.
Complementary treats for large breed dogs developed by nutritionists and vets at Waltham Centre for Pet Nutrition.
Pack of 12 Chews

Pedigree dog treats offer delicious, low-fat dog treats and dog chews for guilt-free treats over the festive period. Pedigree Jumbone large dog treats for Christmas cleverly combine a tough chewy outer with a succulent, tasty centre, for turkey dog treats your pooch will love. Ideal for training, rewarding, or treating at any time.

Nutrition: Analytical constituents (%): Protein: 7.0, Fat content: 1.4, Inorganic matter: 3.8, Crude fibre: 3.0, Calcium: 0.60, Omega 3 fatty acids: 800 mg/kg, Energy: 317 kcal/100 g, Additives per kg: Nutritional additives: Vitamin A: 5000 IU, Vitamin E: 50.0 mg, Iron (Iron(II) sulphate monohydrate): 15.0 mg, Sensory additives: Turkey flavour: 1.5 mg

Preparation and Usage: Feeding instructions: Large dogs (25 kg+) feed up to 1 chew per week. Each chew provides 8% of the weekly energy requirements of a 25 kg dog. Please reduce the main meal accordingly. Not suitable for dogs under 25 kg or puppies under 9 months. Use within 14 days of opening. Fresh drinking water should always be available.

Ingredients: Cereals, Derivatives of Vegetable Origin, Various Sugars, Minerals, Meat and Animal Derivatives, Vegetable Protein Extracts, Seeds, Oils and Fats, Sage

At Pedigree, we believe that dogs are good for us. The Pedigree complete range of tasty and wholesome dog treats, dog chews and dental treats delivers everything that is essential to support and fuel your canine’s exuberant love of life. So that day after day, dog owners can feed the good in their dogs.

Prompt Delivery and Professional Packaging

We are able offer many shipping options thanks to our long-term partnership with UPS FedEx DHL. Our warehouse personnel will pack every item to our exacting specifications. Your products will be subjected to a thorough examination and will be properly packaged prior to being delivered. We deliver to thousands of customers each day in different countries. This shows our commitment to becoming the biggest retailer online in the world. The warehouses are located situated in Europe as much as they are in USA.

Orders that include more than one item are given processing time in accordance with the item.

Before shipping We will inspect thoroughly the items you've purchased. The majority of orders are delivered within 48 hours. Delivery time ranges between 3-7 days.

Returns

Due to the multiple parties involved, including the factory and the warehouse, we're unable to completely manage our stock. Therefore, the actual inventory could fluctuate at any moment. It's possible that your order will become unfulfilled when you have placed the order.

The policy is 30 days. Unfortunately, if thirty days have passed from the date you purchased the item, we cannot provide a refund or exchange.

In order to be eligible for a return your product must be unopened and in the same condition as when you received it. It must also be in the original packaging.

Christmas Jumbone Large Dog Treat with Turkey Flavour 12 Chews Pedigree

Related products

Login