Sale!

findyourdentastixdailydentalchewssmalldog56stickspedigreewidevarietyisavailable0.png

findyourdentastixdailydentalchewssmalldog56stickspedigreewidevarietyisavailable1.png

DentaStix Daily Dental Chews Small Dog 56 Sticks Pedigree

$ 5,39

SKU: mode_6916763123852 Category: Pet Food Tags: Dog Food, Non-Discountable

Description
shopping

DentaStix Daily Oral Care dental chews for dogs are scientifically proven to reduce tartar build-up by up to 80% when fed daily.
Pedigree DentaStix Daily Oral Care dog dental chew sticks were developed with the help of vets and nutritionists at The Waltham Centre.
Dentastix dental treats for dogs are low in fat, with no added sugar and free from artificial colours and flavours; a healthy dog treat with benefits.
Pedigree daily dog chews available in single & multipack & in different sized packs to provide effective oral care for small, medium and large dogs.
At Pedigree we are committed to building a better world for us and our dogs. Our cardboard boxes are 100% recyclable. Inner sachets are not yet. We are working on it!

Dogs love to explore the world through their mouth, so it’s important to take care of their teeth. Pedigree Dentastix Daily Oral Care chews with TRIPLE ACTION are scientifically proven to reduce the build-up of tartar by up to 80%, clean hard-to-reach teeth and support gum health.

Nutrition: Analytical constituents (%): Protein: 8.1, Fat content: 1.3, Inorganic matter: 6.3, Crude fibre: 0.20, Moisture: 15.4, Energy: 301 kcal/100 g, Additives per kg: Nutritional additives: Vitamin E: 1365 mg, Zinc (Zinc sulphate, heptahydrate): 190 mg, Sensory additives: Beef flavour: 11.5 mg, Chicken flavour: 20.1 mg

Preparation and Usage: Feeding instructions: Small dogs, e.g. a Dachshund, feed 1 stick per day. This is a chewy treat that is only suitable for dogs between 5 kg and 10 kg. It is not suitable for young puppies under 4 months. Use each sachet within 14 days of opening. Fresh drinking water should always be available.

Ingredients: Cereals, Derivatives of Vegetable Origin, Minerals (including Sodium Tripolyphosphate 2.3%), Meat and Animal Derivatives, Oils and Fats

At Pedigree we believe that every dog deserves a loving home and that every dog deserves leading nutrition, care, and treats. Pedigree offers delicious dog treats, oral care dog chews, & 100% main meals for dogs.

Prompt Delivery and Professional Packaging

We are able offer many shipping options thanks to our long-term partnership with UPS FedEx DHL. Our warehouse personnel will pack every item to our exacting specifications. Your products will be subjected to a thorough examination and will be properly packaged prior to being delivered. We deliver to thousands of customers each day in different countries. This shows our commitment to becoming the biggest retailer online in the world. The warehouses are located situated in Europe as much as they are in USA.

Orders that include more than one item are given processing time in accordance with the item.

Before shipping We will inspect thoroughly the items you've purchased. The majority of orders are delivered within 48 hours. Delivery time ranges between 3-7 days.

Returns

Due to the multiple parties involved, including the factory and the warehouse, we're unable to completely manage our stock. Therefore, the actual inventory could fluctuate at any moment. It's possible that your order will become unfulfilled when you have placed the order.

The policy is 30 days. Unfortunately, if thirty days have passed from the date you purchased the item, we cannot provide a refund or exchange.

In order to be eligible for a return your product must be unopened and in the same condition as when you received it. It must also be in the original packaging.

DentaStix Daily Dental Chews Small Dog 56 Sticks Pedigree

Related products

Login