Sale!

weareproudofgivingeachcustomerweserveasiftheyarefamilymembershelpingcustomerslocatethedentalifemediumdogdentaldogchews15stickspurina0.jpg

Dentalife Medium Dog Dental Dog Chews, 15 Sticks Purina

$ 2,42

SKU: mode_7197385326732 Category: Pet Food Tags: Dog Food, Non-Discountable

Description
shopping

Chewy porous texture with wholesome ingredients.
Cleans even the hard to reach teeth.
Scientifically proven to help reduce tartar build-up.
Natural cleaning action.
Made with natural ingredients* with no added artificial flavourings or colourants and low in fat.

Your dog has specific health needs, and maintaining good oral health contributes positively to his overall well-being. That’s why the experts at PURINA developed PURINA DENTALIFE, an innovative dental chew that is scientifically proven to help scrub even those hard-to-reach back teeth, that are the most vulnerable to plaque and tartar build up. Our dental chews are designed for daily usage, and everyday chewing means more time cleaning

Ingredients & Nutrition

Ingredients
Cereals* (62% extruded corn flour, 5% wheat flour)
Glycerol
Minerals
Yeasts*
Meat and animal derivatives
Oils and fats

Calories
69kCals per stick

Nutrition & Analytical Constituents
Protein: 7.1%
Fat content: 2.4%
Crude fibre: 0.7%
Crude ash: 4.3%
Calcium: 0.9%
Moisture: 14.5%

Nutritional additives
IU/kg:
Vit A: 8500;
Vit D3: 570;
Vit E: 60.

mg/kg:
Calcium iodate anhydrous (I: 1.4);
Manganous sulphate monohydrate (Mn: 4.0);
Zinc sulphate monohydrate (Zn: 100);
Sodium selenite (Se: 0.14).
Antioxidants.

Feeding Guide

For a medium dog from 12kg to 25kg: 1 stick per day.
Fresh drinking water should always be available.
Supervise your dog when giving him/her the treat.
For your dog’s health respect the feeding guide and exercise him daily.

Technical Specification:

Each Stick: 123mm (Length) x 22mm (Diameter)
Weight Per Stick: 23g Approx
Suitable For: A small dog from 7kg to 12kg

Dimensions: Length: 233mm x Height: 80mm
Weight: 0.345Kg

Prompt Delivery and Professional Packaging

We are able offer many shipping options thanks to our long-term partnership with UPS FedEx DHL. Our warehouse personnel will pack every item to our exacting specifications. Your products will be subjected to a thorough examination and will be properly packaged prior to being delivered. We deliver to thousands of customers each day in different countries. This shows our commitment to becoming the biggest retailer online in the world. The warehouses are located situated in Europe as much as they are in USA.

Orders that include more than one item are given processing time in accordance with the item.

Before shipping We will inspect thoroughly the items you've purchased. The majority of orders are delivered within 48 hours. Delivery time ranges between 3-7 days.

Returns

Due to the multiple parties involved, including the factory and the warehouse, we're unable to completely manage our stock. Therefore, the actual inventory could fluctuate at any moment. It's possible that your order will become unfulfilled when you have placed the order.

The policy is 30 days. Unfortunately, if thirty days have passed from the date you purchased the item, we cannot provide a refund or exchange.

In order to be eligible for a return your product must be unopened and in the same condition as when you received it. It must also be in the original packaging.

Dentalife Medium Dog Dental Dog Chews, 15 Sticks Purina

Ingredients & Nutrition

Feeding Guide

Technical Specification:

Related products

Login