Sale!

weareproudofgivingeachcustomerweserveasiftheywerefamilymembersfindingthejuniorlargebreeddogturkeyrice15kgjameswellbelovedforourcustomersisourgoal0.png

Junior Large Breed Dog Turkey & Rice 15kg James Wellbeloved

$ 34,86

SKU: mode_6915991011468 Category: Pet Food Tags: Dog Food, Non-Discountable

Description
shopping

Controlled Nutrient Levels For Adolescent Development | Naturally Hypoallergenic | Gentle On Sensitive Tummies | Supports The Immune System

This product contains the following special ingredients and benefits to care for your dog’s health and well-being:

Turkey Meal – Made with 100% natural turkey.
Brown & White Rice – A highly digestible carbohydrate and energy source, believed to be gentle on the stomach.
Yucca Extract – A natural deodoriser, for less smelly poos.
Strong Body – Support for joints and heart.
Prebiotics – Natural inulin from chicory, helping to maintain a healthy gut flora.
Antioxidants – Natural antioxidants from pomegranate, green tea and rosemary to support the immune system.

This recipe has been carefully formulated to meet the developmental requirements of the older puppy, at a time when balancing muscular and skeletal development is so important. To create it, we’ve taken a handful of nature’s nourishing ingredients and combined them with flavourful turkey for highly digestible, quality protein. Then, using all our knowledge and experience, we’ve added all the vitamins and minerals your pet needs to stay happy, healthy and full of life.

Ingredients:
turkey meal (24.5%), brown rice (17.5%), white rice (14.3%), naked oats, pea protein, turkey fat (5.6%), whole linseed, turkey gravy (2.9%), sugar beet pulp, alfalfa meal, pea fibre, seaweed, potassium chloride, sodium chloride, fish oil, nettles (0.125%), parsley (0.125%), chicory extract (0.1%), calcium carbonate, glucosamine (0.045%), yucca extract (0.02%), chondroitin (0.005%), green tea extract (0.003%), rosemary extract (0.001%), pomegranate extract (0.001%).

Based in Somerset, we’ve been making nutritionally complete pet food since 1992. Naturally hypoallergenic, it’s gentle on digestion. And with a blend of dietary fibres for firmer poos and omega fatty acids for a glossy coat, it’ll help keep your pet active, happy and healthy, from the inside out.
Made with a single source animal protein and naturally hypoallergenic.
None of these common allergens in this recipe: beef, pork, soya, eggs, dairy or wheat.
No added artificial colours, flavours or antioxidants.
Ideal for dogs with skin and stomach sensitivities.

Prompt Delivery and Professional Packaging

We are able offer many shipping options thanks to our long-term partnership with UPS FedEx DHL. Our warehouse personnel will pack every item to our exacting specifications. Your products will be subjected to a thorough examination and will be properly packaged prior to being delivered. We deliver to thousands of customers each day in different countries. This shows our commitment to becoming the biggest retailer online in the world. The warehouses are located situated in Europe as much as they are in USA.

Orders that include more than one item are given processing time in accordance with the item.

Before shipping We will inspect thoroughly the items you've purchased. The majority of orders are delivered within 48 hours. Delivery time ranges between 3-7 days.

Returns

Due to the multiple parties involved, including the factory and the warehouse, we're unable to completely manage our stock. Therefore, the actual inventory could fluctuate at any moment. It's possible that your order will become unfulfilled when you have placed the order.

The policy is 30 days. Unfortunately, if thirty days have passed from the date you purchased the item, we cannot provide a refund or exchange.

In order to be eligible for a return your product must be unopened and in the same condition as when you received it. It must also be in the original packaging.

Junior Large Breed Dog Turkey & Rice 15kg James Wellbeloved

Related products

Login